PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.QC09Z
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GATA
Protein Properties Length: 378aa    MW: 41109.5 Da    PI: 7.1116
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.QC09ZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.6e-18260294135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C +Cg+ kTp+WR gp g+ktLCnaCG+++++ +l
  Araip.QC09Z 260 CLHCGADKTPQWRTGPMGPKTLCNACGVRFKSGRL 294
                  99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.5E-16254304IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.044254290IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.95E-14257317No hitNo description
Gene3DG3DSA:3.30.50.103.2E-14258292IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.26E-14259306No hitNo description
PfamPF003209.6E-16260294IPR000679Zinc finger, GATA-type
PROSITE patternPS003440260285IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MEVPEYFVGG YYGTGGDQFS TEKRHGVGGG DQKHGGYGGG GEPFAIDDLL DFSNADAIMS  60
DGFFENVAGN SSTDSSNVTA VDSCNSSVSG GDNHFPAGIV PRAFSSGDPQ FSGGELCVPY  120
DDMAELEWLS NFVEDSFSTE EDLKTLQLLS GGGAAAINGR KPQTPESSSS SENALHPPFD  180
TARNAPFLLH QETPLPGKAR SKRSRAAPGD WSTRLLHLST PPPPKLQTSA MEHKPPTPKV  240
AAPTMTKRRE ANAECLGRKC LHCGADKTPQ WRTGPMGPKT LCNACGVRFK SGRLVPEYRP  300
AASPTFVSTK HSNSHRKVLE LRRQKDMQRQ QQQQQQLMSQ TSIFGVSNGG DEFLIHHHHH  360
HPHHHQQHHC GPDFRHVI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177035.10.0PREDICTED: GATA transcription factor 9-like
TrEMBLV7ASR60.0V7ASR6_PHAVU; Uncharacterized protein
STRINGGLYMA07G01960.21e-177(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-66GATA transcription factor 9